PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG015563t1
Common NameTCM_015563
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family Trihelix
Protein Properties Length: 793aa    MW: 85742.9 Da    PI: 5.6228
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG015563t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix96.72e-3098182187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW++qe+laL+++r++m+ ++r++  k+plWe+vs+k++e g++rs+k+Ckek+en++k+yk++keg+ +r++++s  +++f+qlea
  Thecc1EG015563t1  98 RWPRQETLALLKIRSDMDAAFRDATVKGPLWEDVSRKLAELGYKRSAKKCKEKFENVHKYYKRTKEGRAGRQDGKS--YKFFSQLEA 182
                       8*********************************************************************866665..*******85 PP

2trihelix109.81.7e-34531616187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+k evlaLi++r+ +e+r++++  k+plWee+s+ m++ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+ +tcpyf+ql+a
  Thecc1EG015563t1 531 RWPKAEVLALINLRSGLESRYQEAGPKGPLWEEISAGMSRMGYKRSAKRCKEKWENINKYFKKVKESNKKR-PEDAKTCPYFHQLDA 616
                       8*********************************************************************8.99999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.006495157IPR001005SANT/Myb domain
CDDcd122036.33E-2897162No hitNo description
PROSITE profilePS500906.59797155IPR017877Myb-like domain
PfamPF138376.4E-2197183No hitNo description
PROSITE profilePS500906.806524588IPR017877Myb-like domain
SMARTSM007170.023528590IPR001005SANT/Myb domain
CDDcd122039.03E-32530595No hitNo description
PfamPF138378.1E-24530617No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0009414Biological Processresponse to water deprivation
GO:0010090Biological Processtrichome morphogenesis
GO:0030308Biological Processnegative regulation of cell growth
GO:0032876Biological Processnegative regulation of DNA endoreduplication
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000037Biological Processregulation of stomatal complex patterning
GO:2000038Biological Processregulation of stomatal complex development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 793 aa     Download sequence    Send to blast
MQQGGGEGGG GHQSQYGEMG APTTAVATTT GAVSSSHMVS EQSEQLVEAA SPISSRPPAT  60
GNLDEFMRLA SGGGDDGGDE GDRAGGGGGG AGVASGNRWP RQETLALLKI RSDMDAAFRD  120
ATVKGPLWED VSRKLAELGY KRSAKKCKEK FENVHKYYKR TKEGRAGRQD GKSYKFFSQL  180
EALHTTSSAT AAANLSTPVT PVTAASTASL DVAPVSVGVH MPISSVRIPP ATIPMSSSML  240
AMPGSAPASV PVPPVGAAPA SGHPITTTAA PFGISFSSNS SSSSQGFEDD DDDDDEEDEP  300
GGEPSNMAGT SRKRKRQSSR GGGSTTRRMM EFFEGLMKQV MQKQESMQQR FLEAIEKREQ  360
DRMIREEAWK RQEMARLTRD HELMAHERAI AASRDAAIIS FLQKITGQTV QLPTTVTVSA  420
APPPPTQPAV PVVPPPASIP TAASPLHHPP SLPQQQRSSQ QQQQSVQPHH QHQQQPQAVH  480
QQQHQAQPQN TEVVRHHQQP ISSDVVMAIP EQQVPPQEIG RSGNLEPASS RWPKAEVLAL  540
INLRSGLESR YQEAGPKGPL WEEISAGMSR MGYKRSAKRC KEKWENINKY FKKVKESNKK  600
RPEDAKTCPY FHQLDALHRK KILGGGTSGG FSSFSDQNRP QEETSQQHLD TSEAPPITAA  660
PQSTQPTDQS ENKTGATADV LTRKEGLPGS FCGEGNGEAA KKPEDIVMEL MEDQGMHHQG  720
QSLLVDGYGK IDEPDSDNMV HEEDEDEDED DEDDDELEEE RKMAYKIEYQ RQNASTPNGG  780
GNGAPSFLAM VQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140148KRSAKKCKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039268.10.0Duplicated homeodomain-like superfamily protein, putative isoform 1
TrEMBLA0A061G9R20.0A0A061G9R2_THECC; Duplicated homeodomain-like superfamily protein, putative isoform 1
STRINGSb01g049740.11e-160(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62262746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.15e-48GT-2-like 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]